PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G015100.1
Common NamePHAVU_002G015100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 301aa    MW: 32659.2 Da    PI: 9.6509
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G015100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.49e-20550147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +g+W++eEde l ++v+++G+++W++I++ ++ gR++k+c++rw + 
  Phvul.002G015100.1  5 KGPWSPEEDEALQRLVEKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 50
                        79******************************.***********985 PP

2Myb_DNA-binding56.37.5e-1859101347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++T+eEd+ +v+a++++G++ W+tIar ++ gRt++ +k++w++ 
  Phvul.002G015100.1  59 AFTPEEDDTIVRAHARFGNK-WATIARLLQ-GRTDNAIKNHWNST 101
                         79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.926155IPR017930Myb domain
SuperFamilySSF466891.39E-32298IPR009057Homeodomain-like
SMARTSM007175.4E-18453IPR001005SANT/Myb domain
PfamPF002491.9E-19550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-26658IPR009057Homeodomain-like
CDDcd001671.74E-17749No hitNo description
SMARTSM007172.6E-1456104IPR001005SANT/Myb domain
PROSITE profilePS5129421.24157106IPR017930Myb domain
PfamPF002492.6E-1559101IPR001005SANT/Myb domain
CDDcd001671.05E-1159102No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2359105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDRIKGPWSP EEDEALQRLV EKHGPRNWSL ISKSIPGRSG KSCRLRWCNQ LSPQVEHRAF  60
TPEEDDTIVR AHARFGNKWA TIARLLQGRT DNAIKNHWNS TLKRKCASTM MDDHPPPLKR  120
SVSAGAAIPV STGLYINPPT PGSPSGSDVS ESSAPVASPS HVFRPVPRTA AVLPPVETTS  180
SSSNDPPTSL SLSLPGVDSS EVSNRVTEPA HPVPPPQPSN TIPLLPMMAA PVAMVPQLKP  240
PGLGAFNLSA EFLVVMQEMI RKEVRSYMER QNPNGMCFQA AEDGFRNTSV KRIGISRVDS  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-4141063105C-Myb DNA-Binding Domain
1mse_C3e-4141063105C-Myb DNA-Binding Domain
1gv2_A4e-4141053104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156759.10.0hypothetical protein PHAVU_002G015100g
SwissprotQ9FDW13e-96MYB44_ARATH; Transcription factor MYB44
TrEMBLV7CHD20.0V7CHD2_PHAVU; Uncharacterized protein
STRINGGLYMA11G05550.11e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-82myb domain protein r1